Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (6 families) has a additional strand at the N-terminus |
Family d.17.1.1: Monellin [54404] (1 protein) |
Protein Monellin, B & A chains together [54405] (1 species) |
Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries) |
Domain d2o9ux1: 2o9u X:1001-1096 [138960] automatically matched to d1fa3a_ complexed with so4 |
PDB Entry: 2o9u (more details), 1.15 Å
SCOP Domain Sequences for d2o9ux1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ux1 d.17.1.1 (X:1001-1096) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey qlyvyasdklfradisedyktrgrkllrfngpvppp
Timeline for d2o9ux1: