Lineage for d2o9ux1 (2o9u X:1001-1096)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855302Superfamily d.17.1: Cystatin/monellin [54403] (6 families) (S)
    has a additional strand at the N-terminus
  5. 855303Family d.17.1.1: Monellin [54404] (1 protein)
  6. 855304Protein Monellin, B & A chains together [54405] (1 species)
  7. 855305Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)
  8. 855306Domain d2o9ux1: 2o9u X:1001-1096 [138960]
    automatically matched to d1fa3a_
    complexed with so4

Details for d2o9ux1

PDB Entry: 2o9u (more details), 1.15 Å

PDB Description: monellin (mnei) at 1.15 resolution
PDB Compounds: (X:) Monellin chain B and Monellin chain A

SCOP Domain Sequences for d2o9ux1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ux1 d.17.1.1 (X:1001-1096) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp

SCOP Domain Coordinates for d2o9ux1:

Click to download the PDB-style file with coordinates for d2o9ux1.
(The format of our PDB-style files is described here.)

Timeline for d2o9ux1: