Lineage for d2hy5b1 (2hy5 B:205-336)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848497Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 848498Superfamily c.114.1: DsrEFH-like [75169] (2 families) (S)
  5. 848499Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 848511Protein Intracellular sulfur oxidation protein DsrF [142102] (1 species)
  7. 848512Species Chromatium vinosum [TaxId:1049] [142103] (2 PDB entries)
    Uniprot O87897 5-136
  8. 848513Domain d2hy5b1: 2hy5 B:205-336 [136866]
    Other proteins in same PDB: d2hy5a1, d2hy5c1

Details for d2hy5b1

PDB Entry: 2hy5 (more details), 1.72 Å

PDB Description: Crystal structure of DsrEFH
PDB Compounds: (B:) Intracellular sulfur oxidation protein dsrF

SCOP Domain Sequences for d2hy5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hy5b1 c.114.1.1 (B:205-336) Intracellular sulfur oxidation protein DsrF {Chromatium vinosum [TaxId: 1049]}
vkkfmylnrkapygtiyawealevvligaafdqdvcvlflddgvyqltrgqdtkgigmkn
fsptyrtlgdyevrriyvdrdsleargltqddlveiafedmeteeefdnivevidsarvs
elmnesdavfsf

SCOP Domain Coordinates for d2hy5b1:

Click to download the PDB-style file with coordinates for d2hy5b1.
(The format of our PDB-style files is described here.)

Timeline for d2hy5b1: