Lineage for d2h21a1 (2h21 A:311-486)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779606Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 779607Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) (S)
  5. 779608Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)
  6. 779609Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)
  7. 779610Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries)
  8. 779626Domain d2h21a1: 2h21 A:311-486 [135976]
    Other proteins in same PDB: d2h21a2, d2h21b2, d2h21c2
    automatically matched to d1mlvb1
    complexed with sam

Details for d2h21a1

PDB Entry: 2h21 (more details), 2.45 Å

PDB Description: structure of rubisco lsmt bound to adomet
PDB Compounds: (A:) Ribulose-1,5 bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d2h21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h21a1 a.166.1.1 (A:311-486) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum) [TaxId: 3888]}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenly

SCOP Domain Coordinates for d2h21a1:

Click to download the PDB-style file with coordinates for d2h21a1.
(The format of our PDB-style files is described here.)

Timeline for d2h21a1:

779626
d2h21a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2h21a2