Lineage for d2g5ca1 (2g5c A:201-310)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773947Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 773948Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 774118Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein)
    new dimerisation mode with swapping of C-terminal helices
  6. 774119Protein Prephenate dehydrogenase TyrA [140781] (3 species)
  7. 774120Species Aquifex aeolicus [TaxId:63363] [140782] (1 PDB entry)
    Uniprot O67636 201-310
  8. 774121Domain d2g5ca1: 2g5c A:201-310 [134646]
    Other proteins in same PDB: d2g5ca2, d2g5cb2, d2g5cc2, d2g5cd2
    complexed with nad

Details for d2g5ca1

PDB Entry: 2g5c (more details), 1.9 Å

PDB Description: Crystal Structure of Prephenate Dehydrogenase from Aquifex aeolicus
PDB Compounds: (A:) prephenate dehydrogenase

SCOP Domain Sequences for d2g5ca1:

Sequence, based on SEQRES records: (download)

>d2g5ca1 a.100.1.12 (A:201-310) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}
spelhdyvfgvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwr
diflenkenvmkaiegfekslnhlkelivreaeeelveylkevkikrmei

Sequence, based on observed residues (ATOM records): (download)

>d2g5ca1 a.100.1.12 (A:201-310) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}
spelhdyvfgvvshlphavafalvdtlihmstpevdlfkypgggfkdfaksdpimwrdif
lenkenvmkaiegfekslnhlkelivreaeeelveylkevkikrmei

SCOP Domain Coordinates for d2g5ca1:

Click to download the PDB-style file with coordinates for d2g5ca1.
(The format of our PDB-style files is described here.)

Timeline for d2g5ca1: