Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Presequence protease 1, PREP1 [143498] (1 species) duplication: comprises four domains of this fold; similar to the MPP alpha-beta heterodimer |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143499] (1 PDB entry) Uniprot Q9LJL3 100-356! Uniprot Q9LJL3 357-624! Uniprot Q9LJL3 625-882! Uniprot Q9LJL3 883-1078 |
Domain d2fgea2: 2fge A:798-993 [133431] complexed with cl, mg, zn; mutant |
PDB Entry: 2fge (more details), 2.1 Å
SCOP Domain Sequences for d2fgea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgea2 d.185.1.1 (A:798-993) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lplrneaiviptqvnyvgkagniystgyeldgsayviskhisntwlwdrvrvsggayggf cdfdshsgvfsylsyrdpnllktldiydgtgdflrgldvdqetltkaiigtigdvdsyql pdakgyssllrhllgvtdeerqrkreeilttslkdfkdfaqaidvvrdkgvavavasaed idaannersnffevkk
Timeline for d2fgea2:
View in 3D Domains from other chains: (mouse over for more information) d2fgeb1, d2fgeb2, d2fgeb3, d2fgeb4 |