Lineage for d2ctda1 (2ctd A:8-60)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHCSuperfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) 
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins) 
Protein Zinc finger protein 512, ZNF512 [144135] (1 species) Species Human (Homo sapiens) [TaxId:9606] [144136] (1 PDB entry)
Uniprot Q96ME7 142-194! Uniprot Q96ME7 195-224
Domain d2ctda1: 2ctd A:8-60 [130792]
ZnF 1
complexed with zn
Details for d2ctda1
PDB Entry: 2ctd (more details)
PDB Description: solution structure of two zf-c2h2 domains from human zinc finger protein 512
PDB Compounds: (A:) Zinc finger protein 512SCOP Domain Sequences for d2ctda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctda1 g.37.1.1 (A:8-60) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]}
rirkeppvyaagsleeqwyleivdkgsvscptcqavgrktieglkkhmenckq
SCOP Domain Coordinates for d2ctda1:
Click to download the PDB-style file with coordinates for d2ctda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ctda1:
- d2ctda1 first appeared in SCOP 1.73
- d2ctda1 appears in SCOPe 2.01
- d2ctda1 appears in the current release, SCOPe 2.08
View in 3D
