Lineage for d2choa3 (2cho A:5-126)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 868202Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 868271Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 868272Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. 868273Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (7 PDB entries)
    Uniprot Q89ZI2 25-147
  8. 868274Domain d2choa3: 2cho A:5-126 [130481]
    Other proteins in same PDB: d2choa1, d2choa2, d2chob1, d2chob2
    automatically matched to 2CHN A:4-126
    complexed with act, ca, gol

Details for d2choa3

PDB Entry: 2cho (more details), 1.85 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity
PDB Compounds: (A:) glucosaminidase

SCOP Domain Sequences for d2choa3:

Sequence, based on SEQRES records: (download)

>d2choa3 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd
ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy
ps

Sequence, based on observed residues (ATOM records): (download)

>d2choa3 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

SCOP Domain Coordinates for d2choa3:

Click to download the PDB-style file with coordinates for d2choa3.
(The format of our PDB-style files is described here.)

Timeline for d2choa3: