Lineage for d2bsya1 (2bsy A:4-116)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.4: dUTPase-like [51283] (1 family) 
forms tight trimer through an additional beta-sheet in each subunit
subunit beta-sheets are orthogonally packed around the three-fold axisFamily b.85.4.1: dUTPase-like [51284] (4 proteins) 
Protein Monomeric viral dUTPase [141655] (1 species)
related to the trimeric dUTPase domain by domain duplication, fusion and partial deletion; retains only one of the three ancestral active sitesSpecies Epstein-barr virus [TaxId:10376] [141656] (2 PDB entries)
Uniprot P03195 121-256! Uniprot P03195 4-116
Human herpesvirus 4
Domain d2bsya1: 2bsy A:4-116 [129129]
Domain 1
complexed with so4, ump
Details for d2bsya1
PDB Entry: 2bsy (more details), 1.5 Å
PDB Description: epstein barr virus dutpase
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolaseSCOP Domain Sequences for d2bsya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsya1 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]}
cphiryafqndklllqqasvgrltlvnkttillrpmktttvdlglyarppeghglmlwgs
tsrpvtshvgiidpgytgelrlilqnqrrynstlrpselkihlaafryatpqm
SCOP Domain Coordinates for d2bsya1:
Click to download the PDB-style file with coordinates for d2bsya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bsya1:
- d2bsya1 first appeared in SCOP 1.73
- d2bsya1 appears in SCOPe 2.01
- d2bsya1 appears in the current release, SCOPe 2.08
View in 3D
