Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.10: NE0471 C-terminal domain-like [140523] (1 protein) |
Protein Hypothetical protein NE0471 C-terminal domain [140524] (1 species) |
Species Nitrosomonas europaea [TaxId:915] [140525] (1 PDB entry) Uniprot Q82X29 88-154 |
Domain d2auwa1: 2auw A:88-154 [127339] Other proteins in same PDB: d2auwa2, d2auwb2 complexed with fmt, gol |
PDB Entry: 2auw (more details), 1.85 Å
SCOP Domain Sequences for d2auwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} vshemfgdwmhrnnlslttaaealgisrrmvsyyrtahkiiprtiwlaclgweatrpetk tlprtlp
Timeline for d2auwa1: