Lineage for d2auwa1 (2auw A:88-154)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768295Family a.35.1.10: NE0471 C-terminal domain-like [140523] (1 protein)
  6. 768296Protein Hypothetical protein NE0471 C-terminal domain [140524] (1 species)
  7. 768297Species Nitrosomonas europaea [TaxId:915] [140525] (1 PDB entry)
    Uniprot Q82X29 88-154
  8. 768298Domain d2auwa1: 2auw A:88-154 [127339]
    Other proteins in same PDB: d2auwa2, d2auwb2
    complexed with fmt, gol

Details for d2auwa1

PDB Entry: 2auw (more details), 1.85 Å

PDB Description: Crystal Structure of Putative DNA Binding Protein NE0471 from Nitrosomonas europaea ATCC 19718
PDB Compounds: (A:) hypothetical protein NE0471

SCOP Domain Sequences for d2auwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]}
vshemfgdwmhrnnlslttaaealgisrrmvsyyrtahkiiprtiwlaclgweatrpetk
tlprtlp

SCOP Domain Coordinates for d2auwa1:

Click to download the PDB-style file with coordinates for d2auwa1.
(The format of our PDB-style files is described here.)

Timeline for d2auwa1:

768298
d2auwa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2auwa2