Lineage for d2a8na1 (2a8n A:2-131)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the restSuperfamily c.97.1: Cytidine deaminase-like [53927] (5 families) 
contains extra C-terminal strand 5, order 21345Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
strand 5 is parallel to strand 4
Protein Cytidine and deoxycytidylate deaminase CodA [142835] (1 species) Species Agrobacterium tumefaciens [TaxId:358] [142836] (1 PDB entry)
Uniprot Q8UHJ4 2-131
Domain d2a8na1: 2a8n A:2-131 [126408]
complexed with zn
Details for d2a8na1
PDB Entry: 2a8n (more details), 1.6 Å
PDB Description: Biochemical and Structural Studies of A-to-I Editing by tRNA:A34 Deaminases at the Wobble Position of Transfer RNA
PDB Compounds: (A:) cytidine and deoxycytidylate deaminaseSCOP Domain Sequences for d2a8na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8na1 c.97.1.2 (A:2-131) Cytidine and deoxycytidylate deaminase CodA {Agrobacterium tumefaciens [TaxId: 358]}
aerthfmelalvearsagerdevpigavlvldgrviarsgnrtrelndvtahaeiavirm
acealgqerlpgadlyvtlepctmcaaaisfarirrlyygaqdpkggavesgvrffsqpt
chhapdvysg
SCOP Domain Coordinates for d2a8na1:
Click to download the PDB-style file with coordinates for d2a8na1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a8na1:
- d2a8na1 first appeared in SCOP 1.73
- d2a8na1 appears in SCOPe 2.01
- d2a8na1 appears in the current release, SCOPe 2.08
View in 3D
