Lineage for d1ytva1 (1ytv A:15-380)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) 
Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
contains a few additional helices in the C-terminal extension; homologous to thiaminase I
Species Escherichia coli [TaxId:562] [53863] (46 PDB entries)
Uniprot P02928
Domain d1ytva1: 1ytv A:15-380 [124016]
automatically matched to d1mpb__
complexed with mal
Details for d1ytva1
PDB Entry: 1ytv (more details), 1.8 Å
PDB Description: maltose-binding protein fusion to a c-terminal fragment of the v1a vasopressin receptor
PDB Compounds: (A:) Maltose-binding periplasmic proteinSCOP Domain Sequences for d1ytva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytva1 c.94.1.1 (A:15-380) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqt
SCOP Domain Coordinates for d1ytva1:
Click to download the PDB-style file with coordinates for d1ytva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ytva1:
- d1ytva1 first appeared in SCOP 1.73
- d1ytva1 is called d1ytva_ in SCOPe 2.01
- d1ytva1 appears in the current release, SCOPe 2.08, called d1ytva_
View in 3D
