Lineage for d1wzna1 (1wzn A:1-251)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 840258Family c.66.1.43: CAC2371-like [117688] (3 proteins)
    similar overall fold to the Glycine N-methyltransferase ((53348)) and mRNA cap (Guanine N-7) methyltransferase ((102560)) families
    similar overall fold to the Glycine N-methyltransferase ((53348)) and mRNA cap (Guanine N-7) methyltransferase (102560)) families
  6. 840259Protein Hypothetical methyltransferase PH1305 [142601] (1 species)
    the beta-sheet insertion makes trimerization subdomain
  7. 840260Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142602] (1 PDB entry)
    Uniprot O59000 1-251
  8. 840261Domain d1wzna1: 1wzn A:1-251 [121525]
    complexed with mg, sah, so4

Details for d1wzna1

PDB Entry: 1wzn (more details), 1.9 Å

PDB Description: Crystal Structure of the SAM-dependent methyltransferase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) SAM-dependent methyltransferase

SCOP Domain Sequences for d1wzna1:

Sequence, based on SEQRES records: (download)

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
eedlrklfskvaealkpggvfitdfpcwfyggrdgpvvwneqkgeeklvimdwrevepav
qklrfkrlvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspnd
mrywivgiaks

Sequence, based on observed residues (ATOM records): (download)

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
myelytllaeyydtiyrrriervkaeidfveeifkedakrevrrvldlacgtgiptlela
ergyevvgldlheemlrvarrkakernlkieflqgdvleiafknefdavtmffstimyfd
eedlrklfskvaealkpggvfitdfpcgpvvwneqkgeeklvimdwrevepavqklrfkr
lvqilrpngevkaflvddelniytprevrllaekyfekvkiygnlkrelspndmrywivg
iaks

SCOP Domain Coordinates for d1wzna1:

Click to download the PDB-style file with coordinates for d1wzna1.
(The format of our PDB-style files is described here.)

Timeline for d1wzna1: