Lineage for d2bema_ (2bem A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789081Protein Chitin-binding protein CBP21 [117045] (1 species)
    member of Pfam PF03067; elaborated fold with a large insertion between strands A and A'
  7. 789082Species Serratia marcescens [TaxId:615] [117046] (2 PDB entries)
    Uniprot O83009 28-197
  8. 789083Domain d2bema_: 2bem A: [116698]

Details for d2bema_

PDB Entry: 2bem (more details), 1.55 Å

PDB Description: crystal structure of the serratia marcescens chitin-binding protein cbp21
PDB Compounds: (A:) cbp21

SCOP Domain Sequences for d2bema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bema_ b.1.18.2 (A:) Chitin-binding protein CBP21 {Serratia marcescens [TaxId: 615]}
hgyvespasrayqcklqlntqcgsvqyepqsveglkgfpqagpadghiasadkstffeld
qqtptrwnklnlktgpnsftwkltarhsttswryfitkpnwdasqpltrasfdltpfcqf
ndggaipaaqvthqcnipadrsgshvilavwdiadtanafyqaidvnlsk

SCOP Domain Coordinates for d2bema_:

Click to download the PDB-style file with coordinates for d2bema_.
(The format of our PDB-style files is described here.)

Timeline for d2bema_: