Lineage for d1whba_ (1whb A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833370Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 833371Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 833454Family c.46.1.4: Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117586] (1 protein)
  6. 833455Protein Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117587] (1 species)
  7. 833456Species Human (Homo sapiens) [TaxId:9606] [117588] (2 PDB entries)
    Uniprot P40818 174-317
  8. 833460Domain d1whba_: 1whb A: [114639]
    Structural genomics target

Details for d1whba_

PDB Entry: 1whb (more details)

PDB Description: solution structure of the rhodanese-like domain in human ubiquitin specific protease 8 (ubp8)
PDB Compounds: (A:) kiaa0055

SCOP Domain Sequences for d1whba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whba_ c.46.1.4 (A:) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkcetkekgaitakelytmmtdknisliimdarrmqdyqdscilhslsvpeeai
spgvtaswieahlpddskdtwkkrgnveyvvlldwfssakdlqigttlrslkdalfkwes
ktvlrneplvleggyenwllcypqyttnakvsgpssg

SCOP Domain Coordinates for d1whba_:

Click to download the PDB-style file with coordinates for d1whba_.
(The format of our PDB-style files is described here.)

Timeline for d1whba_: