Lineage for d1wf7a_ (1wf7 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 797835Protein Enigma homolog ENH [117174] (1 species)
  7. 797836Species Mouse (Mus musculus) [TaxId:10090] [117175] (1 PDB entry)
    Uniprot Q8CI51 5-94
  8. 797837Domain d1wf7a_: 1wf7 A: [114577]
    Structural genomics target

Details for d1wf7a_

PDB Entry: 1wf7 (more details)

PDB Description: solution structure of the pdz domain of enigma homologue protein
PDB Compounds: (A:) Enigma homologue protein

SCOP Domain Sequences for d1wf7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgsvslvgpapwgfrlqggkdfnmpltisslkdggkasqahvrigdvvlsidgis
aqgmthleaqnkikactgslnmtlqrasaaaksepvssgpssg

SCOP Domain Coordinates for d1wf7a_:

Click to download the PDB-style file with coordinates for d1wf7a_.
(The format of our PDB-style files is described here.)

Timeline for d1wf7a_: