Lineage for d1w36c1 (1w36 C:1-347)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831899Family c.37.1.19: Tandem AAA-ATPase domain [81268] (23 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 831952Protein Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain [117552] (1 species)
    each AAA domain contains an all-alpha insert subdomain
  7. 831953Species Escherichia coli [TaxId:562] [117553] (1 PDB entry)
    Uniprot P07648
  8. 831954Domain d1w36c1: 1w36 C:1-347 [114125]
    Other proteins in same PDB: d1w36b1, d1w36b2, d1w36b3, d1w36c3, d1w36d1, d1w36d2, d1w36e1, d1w36e2, d1w36e3, d1w36f3, d1w36g1, d1w36g2

Details for d1w36c1

PDB Entry: 1w36 (more details), 3.1 Å

PDB Description: recbcd:dna complex
PDB Compounds: (C:) exodeoxyribonuclease v gamma chain

SCOP Domain Sequences for d1w36c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w36c1 c.37.1.19 (C:1-347) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]}
mlrvyhsnrldvlealmefivererlddpfepemilvqstgmaqwlqmtlsqkfgiaani
dfplpasfiwdmfvrvlpeipkesafnkqsmswklmtllpqlleredftllrhyltddsd
krklfqlsskaadlfdqylvyrpdwlaqwetghlveglgeaqawqaplwkalveythqlg
qprwhranlyqrfietlesattcppglpsrvficgisalppvylqalqalgkhieihllf
tnpcryywgdikdpaylaklltrqrrhsfedrelplfrdsenagqlfnsdgeqdvgnpll
aswgklgrdyiyllsdlessqeldafvdvtpdnllhniqsdilelen

SCOP Domain Coordinates for d1w36c1:

Click to download the PDB-style file with coordinates for d1w36c1.
(The format of our PDB-style files is described here.)

Timeline for d1w36c1: