Lineage for d1kl9a2 (1kl9 A:3-88)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
barrel, closed; n=5, S=8
Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species) Species Human (Homo sapiens) [TaxId:9606] [74951] (2 PDB entries)
Uniprot P05198
Domain d1kl9a2: 1kl9 A:3-88 [111575]
Other proteins in same PDB: d1kl9a1
complexed with mse, zn
Details for d1kl9a2
PDB Entry: 1kl9 (more details), 1.9 Å
PDB Description: crystal structure of the n-terminal segment of human eukaryotic initiation factor 2alpha
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 subunit 1SCOP Domain Sequences for d1kl9a2:
Sequence, based on SEQRES records: (download)
>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lscrfyqhkfpevedvvmvnvrsiaemgayvslleynniegmillselsrrrirsinkli
rigrnecvvvirvdkekgyidlskrr
Sequence, based on observed residues (ATOM records): (download)
>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lscrfyqhkfpevedvvmvnvrsiaemgayvslleynniegmillselrigrnecvvvir
vdkekgyidlskrr
SCOP Domain Coordinates for d1kl9a2:
Click to download the PDB-style file with coordinates for d1kl9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kl9a2:
- d1kl9a2 first appeared in SCOP 1.71
- d1kl9a2 appears in SCOP 1.73
- d1kl9a2 appears in SCOPe 2.01
- d1kl9a2 appears in the current release, SCOPe 2.08
View in 3D
