Lineage for d1v2ya_ (1v2y A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853598Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 853897Protein Ubiquitin-like protein 3300001g02rik [102784] (1 species)
  7. 853898Species Mouse (Mus musculus) [TaxId:10090] [102785] (1 PDB entry)
  8. 853899Domain d1v2ya_: 1v2y A: [100275]
    structural genomics

Details for d1v2ya_

PDB Entry: 1v2y (more details)

PDB Description: solution structure of mouse hypothetical gene (riken cdna 3300001g02) product homologous to ubiquitin fold
PDB Compounds: (A:) 3300001G02Rik protein

SCOP Domain Sequences for d1v2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmtvrvckmdgevmpvvvvqnatvldlkkaiqryvqlkqereggvqhiswsyvw
rtyhltsagekltedrkklrdygirnrdevsfikklgqksgpssg

SCOP Domain Coordinates for d1v2ya_:

Click to download the PDB-style file with coordinates for d1v2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1v2ya_: