Class a: All alpha proteins [46456] (284 folds) |
Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
Superfamily a.159.2: FF domain [81698] (1 family) |
Family a.159.2.1: FF domain [81699] (3 proteins) |
Protein Hypa/FBP11 [81700] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [81701] (2 PDB entries) Flj21157 |
Domain d1uzca_: 1uzc A: [100222] CASP5; supersedes original entry 1H40 |
PDB Entry: 1uzc (more details)
SCOP Domain Sequences for d1uzca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzca_ a.159.2.1 (A:) Hypa/FBP11 {Human (Homo sapiens) [TaxId: 9606]} qpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkqaf naykvqtek
Timeline for d1uzca_: