Lineage for d1uzca_ (1uzc A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779459Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 779465Superfamily a.159.2: FF domain [81698] (1 family) (S)
  5. 779466Family a.159.2.1: FF domain [81699] (3 proteins)
  6. 779467Protein Hypa/FBP11 [81700] (1 species)
  7. 779468Species Human (Homo sapiens) [TaxId:9606] [81701] (2 PDB entries)
    Flj21157
  8. 779470Domain d1uzca_: 1uzc A: [100222]
    CASP5; supersedes original entry 1H40

Details for d1uzca_

PDB Entry: 1uzc (more details)

PDB Description: the structure of an ff domain from human hypa/fbp11
PDB Compounds: (A:) hypothetical protein flj21157

SCOP Domain Sequences for d1uzca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzca_ a.159.2.1 (A:) Hypa/FBP11 {Human (Homo sapiens) [TaxId: 9606]}
qpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkqaf
naykvqtek

SCOP Domain Coordinates for d1uzca_:

Click to download the PDB-style file with coordinates for d1uzca_.
(The format of our PDB-style files is described here.)

Timeline for d1uzca_: