PDB entry 9xia

View 9xia on RCSB PDB site
Description: x-ray analysis of d-xylose isomerase at 1.9 angstroms: native enzyme in complex with substrate and with a mechanism-designed inactivator
Deposited on 1990-10-11, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.141
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d9xia__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9xia_ (-)
    mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlip
    fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
    rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
    epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
    lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
    asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
    dvdaaaargmaferldqlamdhllgar