PDB entry 9pcy

View 9pcy on RCSB PDB site
Description: high-resolution solution structure of reduced french bean plastocyanin and comparison with the crystal structure of poplar plastocyanin
Deposited on 1991-03-18, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d9pcy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9pcy_ (-)
    levllgsgdgslvfvpsefsvpsgekivfknnagfphnvvfdedeipagvdavkismpee
    ellnapgetyvvtldtkgtysfycsphqgagmvgkvtvn