PDB entry 9pai

View 9pai on RCSB PDB site
Description: cleaved substrate variant of plasminogen activator inhibitor-1
Class: hydrolase inhibitor
Keywords: serpin, hydrolase inhibitor
Deposited on 1999-03-11, released 1999-03-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.181
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (PLASMINOGEN ACTIVATOR INHIBITOR-1) residues 19-364
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (0-345)
      • mutation (334)
    Domains in SCOPe 2.06: d9paia_
  • Chain 'B':
    Compound: PROTEIN (PLASMINOGEN ACTIVATOR INHIBITOR-1) residues 365-397
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9paiA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvaqalqkvkievnesgtvpssstavivsar
    

  • Chain 'B':
    No sequence available.