PDB entry 9ldt

View 9ldt on RCSB PDB site
Description: design and synthesis of new enzymes based on the lactate dehydrogenase framework
Class: oxidoreductase(choh(d)-nad+(a))
Keywords: oxidoreductase(choh(d)-nad+(a))
Deposited on 1991-11-26, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d9ldta1, d9ldta2
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d9ldtb1, d9ldtb2
  • Heterogens: SO4, NAD, OXM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9ldtA (A:)
    atlkdqlihnllkeehvphnkitvvgvgavgmacaisilmkeladeialvdvmedklkge
    mmdlqhgslflrtpkivsgkdynvtansrlvvitagarqqegesrlnlvqrnvnifkfii
    pnivkyspnckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwilgehgdssvpvwsgvnvagvslknlhpelgtdadkehwkavhkevvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikenvflsvpcilgqngis
    dvvkvtltpeeeahlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9ldtB (B:)
    atlkdqlihnllkeehvphnkitvvgvgavgmacaisilmkeladeialvdvmedklkge
    mmdlqhgslflrtpkivsgkdynvtansrlvvitagarqqegesrlnlvqrnvnifkfii
    pnivkyspnckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwilgehgdssvpvwsgvnvagvslknlhpelgtdadkehwkavhkevvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikenvflsvpcilgqngis
    dvvkvtltpeeeahlkksadtlwgiqkelqf