PDB entry 9ins

View 9ins on RCSB PDB site
Description: monovalent cation binding in cubic insulin crystals
Deposited on 1991-10-23, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-11-07, with a file datestamp of .
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d9ins.1
  • Chain 'B':
    Domains in SCOP 1.55: d9ins.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >9insA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >9insB (B:)
fvnqhlcgshlvealylvcgergffytpka