PDB entry 9gac

View 9gac on RCSB PDB site
Description: precursor of the t152c mutant glycosylasparaginase from flavobacterium meningosepticum
Deposited on 1999-06-15, released 2000-06-16
The last revision prior to the SCOP 1.67 freeze date was dated 2000-06-16, with a file datestamp of 2000-06-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.232
AEROSPACI score: -1.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d9gaca_
  • Chain 'C':
    Domains in SCOP 1.67: d9gacc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >9gacA (A:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhdcigmialdaqgnlsgacttsgmaykmhgr
    vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
    kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >9gacA (A:)
    tnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdg
    rvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkke
    nlltaesekewkewlhdcigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvd
    neigaatatghgeevirtvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiq
    vgfialnkkgeygayciqdgfnfavhdqkgnrletpgfal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >9gacC (C:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhdcigmialdaqgnlsgacttsgmaykmhgr
    vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
    kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >9gacC (C:)
    nkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdgr
    vtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkken
    lltaesekewkewlkhdcigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvd
    neigaatatghgeevirtvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiq
    vgfialnkkgeygayciqdgfnfavhdqkgnrletpgfal