PDB entry 9gaa

View 9gaa on RCSB PDB site
Description: precursor of the t152a mutant glycosylasparaginase from flavobacterium meningosepticum
Deposited on 1999-06-15, released 2000-06-16
The last revision prior to the SCOP 1.67 freeze date was dated 2000-06-16, with a file datestamp of 2000-06-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: -1.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d9gaaa_
  • Chain 'C':
    Domains in SCOP 1.67: d9gaac_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >9gaaA (A:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhdaigmialdaqgnlsgacttsgmaykmhgr
    vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
    kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >9gaaA (A:)
    tnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdg
    rvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkke
    nlltaesekewkewldaigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdn
    eigaatatghgeevirtvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqv
    gfialnkkgeygayciqdgfnfavhdqkgnrletpgfal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >9gaaC (C:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhdaigmialdaqgnlsgacttsgmaykmhgr
    vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
    kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >9gaaC (C:)
    tnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdg
    rvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkke
    nlltaesekewkewldaigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdn
    eigaatatghgeevirtvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqv
    gfialnkkgeygayciqdgfnfavhdqkgnrletpgfal