PDB entry 9cgt

View 9cgt on RCSB PDB site
Description: structure of cyclodextrin glycosyltransferase complexed with a thio-maltopentaose
Class: transferase
Keywords: glycosyltransferase, starch degradation, cyclodextrin
Deposited on 1998-09-27, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.147
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cyclodextrin-glycosyltransferase)
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30920 (0-683)
      • engineered (256)
    Domains in SCOPe 2.07: d9cgta1, d9cgta2, d9cgta3, d9cgta4
  • Heterogens: CA, TM5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >9cgtA (A:)
    dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
    indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
    littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
    sdfsslengiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqk
    swmssiyahkpvftfgawflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
    yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
    gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiaygstqqrwinndvyv
    yerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlngnnitstngsinnft
    laagatavwqyttaettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaai
    tswedtqikvtipsvaagnyavkvaasgvnsnaynnftiltgdqvtvrfvvnnasttlgq
    nlyltgnvaelgnwstgstaigpafnqvihqyptwyydvsvpagkqlefkffkkngstit
    wesgsnhtfttpasgtatvtvnwq