PDB entry 966c

View 966c on RCSB PDB site
Description: crystal structure of fibroblast collagenase-1 complexed to a diphenyl-ether sulphone based hydroxamic acid
Class: matrix metalloprotease
Keywords: matrix metalloprotease
Deposited on 1998-08-07, released 1999-08-07
The last revision prior to the SCOP 1.73 freeze date was dated 1999-08-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2181
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mmp-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d966ca_
  • Heterogens: ZN, CA, RS2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >966cA (A:)
    rweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrgd
    hrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgls
    hstdigalmypsytfsgdvqlaqddidgiqaiygrsq