PDB entry 966c

View 966c on RCSB PDB site
Description: crystal structure of fibroblast collagenase-1 complexed to a diphenyl- ether sulphone based hydroxamic acid
Deposited on 1998-08-07, released 1999-08-07
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-07, with a file datestamp of 1999-08-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d966c__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >966c_ (-)
  rweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrgd
  hrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgls
  hstdigalmypsytfsgdvqlaqddidgiqaiygrsq