PDB entry 8tim

View 8tim on RCSB PDB site
Description: triose phosphate isomerase
Class: isomerase
Keywords: isomerase, glycolysis, gluconeogenesis, fatty acid biosynthesis
Deposited on 1998-08-25, released 1999-02-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triose phosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (0-246)
      • conflict (192)
    Domains in SCOPe 2.01: d8tima_
  • Chain 'B':
    Compound: triose phosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (0-246)
      • conflict (192)
    Domains in SCOPe 2.01: d8timb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8timA (A:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8timB (B:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh