PDB entry 8rxn

View 8rxn on RCSB PDB site
Description: refinement of rubredoxin from desulfovibrio vulgaris at 1.0 angstroms with and without restraints
Deposited on 1991-08-26, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1 Å
R-factor: 0.147
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d8rxna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8rxnA (A:)
    mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa