PDB entry 8pti

View 8pti on RCSB PDB site
Description: crystal structure of a y35g mutant of bovine pancreatic trypsin inhibitor
Class: proteinase inhibitor (trypsin)
Keywords: proteinase inhibitor (trypsin)
Deposited on 1990-12-17, released 1991-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • conflict (34)
    Domains in SCOPe 2.06: d8ptia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8ptiA (A:)
    rpdfcleppytgpckariiryfynakaglcqtfvgggcrakrnnfksaedcmrtcgga