PDB entry 8pti

View 8pti on RCSB PDB site
Description: crystal structure of a y35g mutant of bovine pancreatic trypsin inhibitor
Deposited on 1990-12-17, released 1991-04-15
The last revision prior to the SCOP 1.65 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d8pti__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8pti_ (-)
    rpdfcleppytgpckariiryfynakaglcqtfvgggcrakrnnfksaedcmrtcgga