PDB entry 8lpr

View 8lpr on RCSB PDB site
Description: structural basis for broad specificity in alpha-lytic protease mutants
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1991-08-05, released 1993-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.132
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00778 (Start-197)
      • conflict (157)
    Domains in SCOPe 2.07: d8lpra_
  • Chain 'P':
    Compound: methoxysuccinyl-ala-ala-pro-phenylalanine boronic acid inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 8LPR (4-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8lprA (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg
    

  • Chain 'P':
    No sequence available.