PDB entry 8ldh

View 8ldh on RCSB PDB site
Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1988-01-04, released 1989-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m4 apo-lactate dehydrogenase
    Species: Squalus acanthias [TaxId:7797]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00341 (0-328)
      • conflict (204-205)
      • conflict (207-209)
      • conflict (213-214)
      • conflict (307)
    Domains in SCOPe 2.07: d8ldha1, d8ldha2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8ldhA (A:)
    atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
    emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
    ipnivkhspdciilvvsnpvdvltyvawklsglpmhriigsgcnldsarfrylmgerlgv
    hscschgwvigehgdsvpsvwsgmnvasiklhpldgtnkdkqdwkklhkdvvdsayevik
    lkgytswaiglsvadlaetimknlcrvhpvstmvkdfygikdnvflslpcvlndhgisni
    vkmklkpneeqqlqksattlwdiqkdlkf