PDB entry 8gch

View 8gch on RCSB PDB site
Description: gamma-chymotrypsin is a complex of alpha-chymotrypsin with its own autolysis products
Deposited on 1991-03-27, released 1992-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d8gch__
  • Chain 'E':
    no info in PDB for this chain
  • Chain 'F':
    no info in PDB for this chain
  • Chain 'G':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >8gch_ (-)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >8gch_ (-)
    cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
    vvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclps
    asddfaagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagasgv
    sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.