PDB entry 8fab

View 8fab on RCSB PDB site
Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-03-23, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1-lambda hil fab (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PIR S25738
      • conflict (18)
      • conflict (23-25)
      • conflict (27-29)
      • conflict (32)
      • conflict (40-41)
      • conflict (44)
      • conflict (47-48)
      • conflict (50-51)
      • conflict (58)
      • conflict (62)
      • conflict (64)
      • conflict (67)
      • conflict (69)
      • conflict (76)
      • conflict (79)
      • conflict (91)
      • conflict (93-95)
      • conflict (154)
    Domains in SCOP 1.73: d8faba1, d8faba2
  • Chain 'B':
    Compound: igg1-lambda hil fab (heavy chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA75032 (1-End)
      • conflict (2)
      • conflict (5-6)
      • conflict (22)
      • conflict (49)
      • conflict (53)
      • conflict (56-57)
      • conflict (60)
      • conflict (76)
      • conflict (87)
      • conflict (98-102)
      • conflict (104-106)
      • conflict (114)
      • conflict (217)
    Domains in SCOP 1.73: d8fabb1, d8fabb2
  • Chain 'C':
    Compound: igg1-lambda hil fab (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PIR S25738
      • conflict (18)
      • conflict (23-25)
      • conflict (27-29)
      • conflict (32)
      • conflict (40-41)
      • conflict (44)
      • conflict (47-48)
      • conflict (50-51)
      • conflict (58)
      • conflict (62)
      • conflict (64)
      • conflict (67)
      • conflict (69)
      • conflict (76)
      • conflict (79)
      • conflict (91)
      • conflict (93-95)
      • conflict (154)
    Domains in SCOP 1.73: d8fabc1, d8fabc2
  • Chain 'D':
    Compound: igg1-lambda hil fab (heavy chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA75032 (1-End)
      • conflict (2)
      • conflict (5-6)
      • conflict (22)
      • conflict (49)
      • conflict (53)
      • conflict (56-57)
      • conflict (60)
      • conflict (76)
      • conflict (87)
      • conflict (98-102)
      • conflict (104-106)
      • conflict (114)
      • conflict (217)
    Domains in SCOP 1.73: d8fabd1, d8fabd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >8fabA (A:)
    syeltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqr
    fssstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabA (A:)
    eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
    sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsltp
    eqwkshrsyscqvthegstvektvap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >8fabB (B:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabB (B:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >8fabC (C:)
    syeltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqr
    fssstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabC (C:)
    eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
    sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsltp
    eqwkshrsyscqvthegstvektvap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >8fabD (D:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabD (D:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk