PDB entry 8fab

View 8fab on RCSB PDB site
Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
Deposited on 1992-03-23, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >8fabA (A:)
    syeltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqr
    fssstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabA (A:)
    eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
    sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsltp
    eqwkshrsyscqvthegstvektvap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >8fabB (B:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabB (B:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >8fabC (C:)
    syeltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqr
    fssstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabC (C:)
    eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
    sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsltp
    eqwkshrsyscqvthegstvektvap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >8fabD (D:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabD (D:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk