PDB entry 8fab

View 8fab on RCSB PDB site
Description:
Deposited on 1992-03-23, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d8faba1, d8faba2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d8fabb1, d8fabb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d8fabc1, d8fabc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d8fabd1, d8fabd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >8fabA (A:)
    syeltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqr
    fssstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabA (A:)
    eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
    sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsltp
    eqwkshrsyscqvthegstvektvap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >8fabB (B:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabB (B:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >8fabC (C:)
    syeltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqr
    fssstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabC (C:)
    eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs
    sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltvlgqpkaapsvtlfppss
    eelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsltp
    eqwkshrsyscqvthegstvektvap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >8fabD (D:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >8fabD (D:)
    avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
    gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk