PDB entry 8est

View 8est on RCSB PDB site
Description: reaction of porcine pancreatic elastase with 7-substituted 3-alkoxy-4-chloroisocoumarins: design of potent inhibitors using the crystal structure of the complex formed with 4-chloro-3-ethoxy-7-guanidino-isocoumarin
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1990-02-21, released 1992-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: -
Resolution: 1.78 Å
R-factor: 0.17
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: porcine pancreatic elastase
  Species: Sus scrofa
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • conflict (65)
  Domains in SCOP 1.73: d8este_
• Heterogens: SO4, CA, GIS, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >8estE (E:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn