PDB entry 8cho

View 8cho on RCSB PDB site
Description: crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni
Deposited on 1998-01-06, released 1999-02-02
The last revision prior to the SCOP 1.67 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d8cho__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >8cho_ (-)
  mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaairefyanslk
  lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
  ihaga