PDB entry 8atc

View 8atc on RCSB PDB site
Description: complex of n-phosphonacetyl-l-aspartate with aspartate carbamoyltransferase. x-ray refinement, analysis of conformational changes and catalytic and allosteric mechanisms
Deposited on 1989-08-25, released 1990-10-15
The last revision prior to the SCOP 1.69 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.165
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    Domains in SCOP 1.69: d8atcb1, d8atcb2
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'D':
    Domains in SCOP 1.69: d8atcd1, d8atcd2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >8atcB (B:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperinnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >8atcB (B:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >8atcD (D:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperinnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >8atcD (D:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan