PDB entry 8at1

View 8at1 on RCSB PDB site
Description: crystal structures of aspartate carbamoyltransferase ligated with phosphonoacetamide, malonate, and ctp or atp at 2.8-angstroms resolution and neutral p*h
Deposited on 1989-09-22, released 1990-10-15
The last revision prior to the SCOP 1.69 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.167
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8at1A (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >8at1B (B:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >8at1B (B:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >8at1C (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >8at1D (D:)
    mthdnklgveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >8at1D (D:)
    gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
    edqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfav
    rkrandialkckycekefshnvvlan