PDB entry 8aql

View 8aql on RCSB PDB site
Description: High-resolution crystal structure of human SHMT2
Class: transferase
Keywords: one-carbon metabolism, tetrahydrofolate, folate cycle, mitochondria, TRANSFERASE
Deposited on 2022-08-12, released 2022-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-10-05, with a file datestamp of 2022-09-30.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d8aqla_
  • Chain 'B':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d8aqlb_
  • Chain 'C':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d8aqlc_
  • Chain 'D':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d8aqld_
  • Heterogens: PLG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >8aqlA (A:)
    snaaqtqtgeanrgwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraaleal
    gsclnnkysegypgkryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanl
    avytallqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynq
    laltarlfrprliiagtsayarlidyarmrevcdevkahlladmahisglvaakvipspf
    khadivtttthktlrgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggph
    nhaiaavavalkqactpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrp
    kgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfi
    degvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >8aqlA (A:)
    wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
    kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
    gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
    agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
    rgarsglifyrkgvkipytfedrinfavfpslqggphnhaiaavavalkqactpmfreys
    lqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitanknt
    cpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksf
    llkdsetsqrlanlrqrveqfarafpmpgfdeh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >8aqlB (B:)
    snaaqtqtgeanrgwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraaleal
    gsclnnkysegypgkryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanl
    avytallqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynq
    laltarlfrprliiagtsayarlidyarmrevcdevkahlladmahisglvaakvipspf
    khadivtttthktlrgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggph
    nhaiaavavalkqactpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrp
    kgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfi
    degvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >8aqlB (B:)
    qtgeanrgwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnn
    kysegypgkryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytal
    lqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltar
    lfrprliiagtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadiv
    tttthktlrgarsglifyrkgvkipytfedrinfavfpslqggphnhaiaavavalkqac
    tpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlelv
    sitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevkskta
    klqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >8aqlC (C:)
    snaaqtqtgeanrgwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraaleal
    gsclnnkysegypgkryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanl
    avytallqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynq
    laltarlfrprliiagtsayarlidyarmrevcdevkahlladmahisglvaakvipspf
    khadivtttthktlrgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggph
    nhaiaavavalkqactpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrp
    kgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfi
    degvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >8aqlC (C:)
    wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
    kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
    gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
    agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
    rgarsglifyrkgvkpytfedrinfavfpslqggphnhaiaavavalkqactpmfreysl
    qvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitankntc
    pgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksfl
    lkdsetsqrlanlrqrveqfarafpmpgfdeh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >8aqlD (D:)
    snaaqtqtgeanrgwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraaleal
    gsclnnkysegypgkryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanl
    avytallqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynq
    laltarlfrprliiagtsayarlidyarmrevcdevkahlladmahisglvaakvipspf
    khadivtttthktlrgarsglifyrkgvkavdpktgreipytfedrinfavfpslqggph
    nhaiaavavalkqactpmfreyslqvlknaramadallergyslvsggtdnhlvlvdlrp
    kgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqfreddfrrvvdfi
    degvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >8aqlD (D:)
    wtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypg
    kryyggaevvdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrim
    gldlpdgghlthgymsdvkrisatsiffesmpyklnpktglidynqlaltarlfrprlii
    agtsayarlidyarmrevcdevkahlladmahisglvaakvipspfkhadivtttthktl
    rgarsglifyrkgvkipytfedrinfavfpslqggphnhaiaavavalkqactpmfreys
    lqvlknaramadallergyslvsggtdnhlvlvdlrpkgldgaraervlelvsitanknt
    cpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksf
    llkdsetsqrlanlrqrveqfarafpmpgfdeh