PDB entry 7zc3

View 7zc3 on RCSB PDB site
Description: Crystal structure of human copper chaperone Atox1 bound to zinc ion by CxxC motif
Class: chaperone
Keywords: Copper Transport Protein, Metallochaperone, Atox1 Protein, Metal Ions, Zinc, CHAPERONE
Deposited on 2022-03-25, released 2022-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-11-09, with a file datestamp of 2022-11-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7zc3a_
  • Chain 'B':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Gene: ATOX1, HAH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7zc3b_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7zc3A (A:)
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

    Sequence, based on observed residues (ATOM records): (download) 
    >7zc3A (A:)
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7zc3B (B:)
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

    Sequence, based on observed residues (ATOM records): (download) 
    >7zc3B (B:)
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle