PDB entry 7xit

View 7xit on RCSB PDB site
Description: Crystal structure of engineered HIV-1 Reverse Transcriptase RNase H domain complexed with nitrofuran methoxy(methoxycarbonyl)phenyl ester
Class: viral protein
Keywords: ribonuclease, VIRAL PROTEIN
Deposited on 2022-04-14, released 2022-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-04-27, with a file datestamp of 2022-04-22.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reverse Transcriptase RNase H domain
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7xita1, d7xita2
  • Heterogens: ZN, MN, E6I, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7xitA (A:)
gpggsmyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
aiylalqdsglevnivtdsqyalgiitqwihnwkkrgwktpvknvdlvnqiieqlikkek
vylawvpahkgiggneqvdklvsagirkvlf

    Sequence, based on observed residues (ATOM records): (download) 
    >7xitA (A:)
smyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiyl
alqdsglevnivtdsqyalgiitqwihnwkkrgwktpvknvdlvnqiieqlikkekvyla
wvpahkgiggneqvdklvsagirkv