PDB entry 7vwj

View 7vwj on RCSB PDB site
Description: Matrix arm of deactive state CI from rotenone-NADH dataset
Class: electron transport
Keywords: mammalian, respiratory, complex I, ELECTRON TRANSPORT
Deposited on 2021-11-10, released 2022-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-04-06, with a file datestamp of 2022-04-01.
Experiment type: EM
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1RVN1 (0-430)
  Domains in SCOPe 2.08: d7vwja1, d7vwja2, d7vwja3
• Chain 'B':
  Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A287BDC0 (0-175)
• Chain 'C':
  Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot I3LK43 (0-155)
• Chain 'E':
  Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A480VKQ8 (0-114)
  Domains in SCOPe 2.08: d7vwje_
• Chain 'F':
  Compound: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1RGE3 (0-85)
• Chain 'G':
  Compound: acyl carrier protein, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0G781 (0-87)
  Domains in SCOPe 2.08: d7vwjg_
• Chain 'H':
  Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A5G2RN85 (0-111)
• Chain 'I':
  Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A4X1VLA2 (0-111)
• Chain 'J':
  Compound: NADH dehydrogenase ubiquinone 1 alpha subcomplex subunit 9, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A480QJC4 (0-340)
• Chain 'K':
  Compound: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A4X1TFI3 (0-41)
• Chain 'L':
  Compound: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot G8IFA6 (0-124)
• Chain 'M':
  Compound: nadh-ubiquinone oxidoreductase 75 kda subunit, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1SHD7 (0-689)
• Chain 'N':
  Compound: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1SQP4 (0-143)
• Chain 'O':
  Compound: nadh dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A287BG40 (0-216)
• Chain 'P':
  Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A286ZNN4 (0-207)
• Chain 'Q':
  Compound: nadh dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A480JYS1 (0-384)
  Domains in SCOPe 2.08: d7vwjq_
• Chain 'T':
  Compound: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1S031 (0-95)
• Chain 'W':
  Compound: nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot F1S6Q1 (0-28)
• Heterogens: 2MR, 8Q1, CDL, FES, FMN, MG, NAI, NDP, PEE, PLX, SF4, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7vwjA (A:)
  kktsfgslkdedriftnlygrhdwrlkgaqsrgdwyktkeillkgpdwilgevktsglrg
  rggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreiirhdphklvegclvggr
  amgaraayiyirgefyneasnlqvaireayeagligknacgsgydfdvfvvrgagayicg
  eetaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggawfasfgr
  ernsgtklfnisghvnhpctveeemsvplkeliekhaggviggwdnllavipggsstpli
  pksvcetvlmdfdalvqaqtglgtaavivmdrstdivkaiarliefykhescgqctpcre
  gvdwmnkvmarfvkgdarpaeidslweiskqieghticalgdgaawpvqglirhfrpele
  ermqqfalqhq
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7vwjE (E:)
  gtsvkpifsrdmneakrrvrelyrawyrevpntvhlfqldisvkqgrdkvremfmknahv
  tdprvvdllvikgkmeleetinvwkqrthimrffheteaprptdflskfyvghdp
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7vwjG (G:)
  sdappltleaikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgf
  eipdidaeklmcpqeivdyiadkkdvye
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  Sequence, based on SEQRES records: (download)
  

  >7vwjQ (Q:)
  nltlnfgpqhpaahgvlrlvmelsgemvrkcdphigllhrgteklieyktylqalpyfdr
  ldyvsmmcneqayslavekllniqpppraqwirvlfgeitrllnhimavtthaldigamt
  pffwmfeerekmfefyervsgarmhaayirpggvhqdlplgllddiyefsknfsfridel
  eemltnnriwrnrtvdigvvtaedalnygfsgvmlrgsgiqwdlrktqpydvydqvefdv
  pigsrgdcydrylcrveemrqslriisqclnkmppgeikvddakvsppkraemktsmesl
  ihhfklytegyqvppgatytaieapkgefgvylvsdgssrpyrckikapgfahlagldkm
  skghmladvvaiigtqdivfgevdr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7vwjQ (Q:)
  nltlnfgpgvlrlvmelsgemvrkcdphigllhrgteklieyktylqalpyfdrldyvsm
  mcneqayslavekllniqpppraqwirvlfgeitrllnhimavtthaldigamtpffwmf
  eerekmfefyervsgarmhaayirpggvhqdlplgllddiyefsknfsfrideleemltn
  nriwrnrtvdigvvtaedalnygfsgvmlrgsgiqwdlrktqpydvydqvefdvpigsrg
  dcydrylcrveemrqslriisqclnkmppgeikvddakvsppkraemktsmeslihhfkl
  ytegyqvppgatytaieapkgefgvylvsdgssrpyrckikapgfahlagldkmskghml
  advvaiigtqdivfgevdr
  

  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.