PDB entry 7ugt

View 7ugt on RCSB PDB site
Description: Crystal structure of hyperfolder fluorescent protein FOLD6
Class: fluorescent protein
Keywords: hyperfolder, fluorescent protein, superfolder, GFP, hfYFP
Deposited on 2022-03-25, released 2022-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-12-14, with a file datestamp of 2022-12-09.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fold6
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 7UGT (0-230)
    Domains in SCOPe 2.08: d7ugta_
  • Heterogens: CR2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7ugtA (A:)
hmvskgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkfisttgklpvpwp
tlvttlgyglavfarypdhmkqhdffksampegyvqertisfeddgyyktraevkfegdt
lvnrivlkgidfkedgnilghkleynfnphnvyitadkqkngikanfktrhnvedggvql
adhyqqntpigdgpvllpdnhylshqsvlskdpnekrdhmvllefvtaagi