PDB entry 7tim

View 7tim on RCSB PDB site
Description: structure of the triosephosphate isomerase-phosphoglycolohydroxamate complex: an analogue of the intermediate on the reaction pathway
Class: intramolecular oxidoreductase
Keywords: intramolecular oxidoreductase
Deposited on 1991-04-23, released 1993-10-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d7tima_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d7timb_
  • Heterogens: PGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7timA (A:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7timB (B:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn