PDB entry 7taa

View 7taa on RCSB PDB site
Description: family 13 alpha amylase in complex with acarbose
Class: hydrolase
Keywords: hydrolase, glycosyl hydrolase, taka, amylase, acarbose
Deposited on 1997-10-06, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: taka amylase
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7taaa1, d7taaa2
  • Heterogens: ABC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7taaA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskicsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >7taaA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskics